PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000875.1_g00017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 447aa    MW: 49025.1 Da    PI: 4.4538
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000875.1_g00017.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM124.68.5e-3961331128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkk..leleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l pGfrFhPtd el+ + Lk+kv g++   e++++i+e+++  ++P++L++k +++++ wyfF++ +kkya+g++ +rat++gyWk
  Itr_sc000875.1_g00017.1   6 LFPGFRFHPTDVELM-YCLKHKVIGRElpSEVKRAIPELNVRLYHPSELREKSSSKDRMWYFFCPIEKKYASGSKLKRATETGYWK 90 
                              579************.88*****999965666778**************98889999***************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +tg d++v+  kg++vg  ktL+f++g++ kge+tdWv+heyr+
  Itr_sc000875.1_g00017.1  91 STGGDRTVTY-KGRTVGKIKTLIFHQGHSGKGERTDWVIHEYRM 133
                              **********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-474156IPR003441NAC domain
PROSITE profilePS5100544.3716156IPR003441NAC domain
PfamPF023651.3E-198133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MANTTLFPGF RFHPTDVELM YCLKHKVIGR ELPSEVKRAI PELNVRLYHP SELREKSSSK  60
DRMWYFFCPI EKKYASGSKL KRATETGYWK STGGDRTVTY KGRTVGKIKT LIFHQGHSGK  120
GERTDWVIHE YRMEDKHLAD ARIVQDSYVI CKVFKKTGPG PQNGSQYGSF EEDWDYDDVC  180
AEPDLSGVSP AMPASTDCQS CPVGIESTSS FALVEPGPSS AEPGSSLAEP HINELSEGGD  240
INELLGPFFM EHNGLLPIES NNNENTSDLT QARCVEIAEC NDGDDIYNDL GGLGNLPMLG  300
EDGFSNILYP WEETTAYYGY TDAYINQARS AEIAECNMTA AAAAAAAAYF GDSLGGLGNL  360
PTLGEDGFGD TAGYVELDDL LKPLDESNCG SETQHSYPSY NNNVAIDVEQ SHIRGNTTSG  420
SNEFDPSSAT RGVHHIQKET IGAYNSW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-32215611168Stress-induced transcription factor NAC1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631915.25e-77PREDICTED: NAC domain-containing protein 45
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60502334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.43e-61NAC domain containing protein 82